PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G1161
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 522aa    MW: 58040.3 Da    PI: 7.2307
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G1161genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.3e-152471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed  l+++v+ +G g+W+++ r  g+ R++k+c++rw ++l
      Gh_A13G1161 24 KGPWTAAEDAVLAEYVRTHGEGNWNAVQRNTGLARCGKSCRLRWANHL 71
                     79******************************************9986 PP

2Myb_DNA-binding48.22.5e-1577120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ ++v++++ +G++ W++ a++++ gRt++++k++w++
      Gh_A13G1161  77 KGAFSPEEERIIVELHAIMGNK-WARMAARLP-GRTDNEIKNYWNT 120
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3381971IPR017930Myb domain
SuperFamilySSF466891.37E-2822118IPR009057Homeodomain-like
SMARTSM007174.6E-122373IPR001005SANT/Myb domain
PfamPF002498.1E-142471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-232578IPR009057Homeodomain-like
CDDcd001677.77E-102671No hitNo description
PROSITE profilePS5129424.8872126IPR017930Myb domain
SMARTSM007176.8E-1676124IPR001005SANT/Myb domain
PfamPF002494.1E-1477120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2479125IPR009057Homeodomain-like
CDDcd001672.67E-1179120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MMGNNNNNHH QVSMQKEEGV MLKKGPWTAA EDAVLAEYVR THGEGNWNAV QRNTGLARCG  60
KSCRLRWANH LRPNLKKGAF SPEEERIIVE LHAIMGNKWA RMAARLPGRT DNEIKNYWNT  120
RVKRRQRQGL PLYPPEIQSL YSQTQPVLTP SSTSSFSFQH STTTLTSSSP STPPRLLAYD  180
PHSAATPPPV QSPSPASTPP PLPSPSHVSP LQSPHKPSFS SIPLADSFTS NTPSSSLDFY  240
FPRPLPSLQQ PLRNKRPRHD ENNTNNGDSS FMLPFSSLMK TDPFNPHTVT NNSLNPQHYS  300
NSYCLDQTTF DMASSSRFPQ PHFDPGQFIS TPRFGYNQLK TELPSNQIFT QVGNSQVRLD  360
PKGNNNYSSH NQIQNSNHHS SSLNISGNGL IEDMLQEVQT LNEKNEIMAS QSCLVRSSSS  420
SEGLASGLEA KEESKEQIMN TAKHVDYSNV NPSSMAMAIP EWYINNGETS IGQSSTVTYD  480
NLALEFELHD QIASLLPIDT APDHHGRSSS SYTWDHSFPG IC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31221255107B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6146031e-147JX614603.1 Gossypium hirsutum clone NBRI_GE58120 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465976.10.0PREDICTED: transcription factor MYB28-like
TrEMBLA0A0B0MT600.0A0A0B0MT60_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.11e-69myb domain protein 101